exceptional video game hardware

2.33 Rating by ClearWebStats
analogueinteractive.com is 1 decade 3 years 2 months old. This website has a #1,476,708 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 4 out of 10. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, analogueinteractive.com is SAFE to browse.
Get Custom Widget

Traffic Report of Analogueinteractive

Daily Unique Visitors: 326
Daily Pageviews: 652

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 289

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for analogueinteractive.com Excellent
WOT Privacy: WOT privacy rank for analogueinteractive.com Excellent
WOT Child Safety: WOT child safety rank for analogueinteractive.com Excellent

Website Ranks & Scores

Google Pagerank: View analogueinteractive.com Pagerank
Alexa Rank: 1,476,708
Domain Authority: Not Applicable
Google Pagerank
PR 4 out of 10
PageSpeed Score
84
Siteadvisor Rating
View analogueinteractive.com site advisor rating Not Applicable

Where is analogueinteractive.com server located?

Hosted IP Address:

204.93.213.45 View other site hosted with analogueinteractive.com

Hosted Country:

analogueinteractive.com hosted country US analogueinteractive.com hosted country

Location Latitude:

41.8777

Location Longitude:

-87.6376

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): 150
Linkedin Shares: 6
Delicious Shares: Not Applicable

Page Resources Breakdown

View analogueinteractive.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 5
Google Adsense: Not Applicable Google Analytics: UA-22738499-3

Websites Hosted on Same IP (i.e. 204.93.213.45)

Corridor Digital | The Official Site. Find news and latest videos.

analogueinteractive.com favicon - corridor-digital.com

View analogueinteractive.com Pagerank   analogueinteractive.com alexa rank 2,917,555   analogueinteractive.com website value $ 240.00

Star Store - Shop the Toronto Star Store | StarStore

analogueinteractive.com favicon - starstore.ca

View analogueinteractive.com Pagerank   analogueinteractive.com alexa rank 2,125,728   analogueinteractive.com website value $ 240.00

ISBS

analogueinteractive.com favicon - isbs.com

View analogueinteractive.com Pagerank   analogueinteractive.com alexa rank 1,752,930   analogueinteractive.com website value $ 480.00

GOOD AS GOLD | Online Clothing Store | Mens & Womens Fashion | Streetwear | NZ

analogueinteractive.com favicon - goodasgold.co.nz

Good As Gold stocks the best fashion and streetwear brands from around the globe...

View analogueinteractive.com Pagerank   analogueinteractive.com alexa rank 268,815   analogueinteractive.com website value $ 18,900.00

Soylent - Free Your Body

analogueinteractive.com favicon - soylent.me

What if you never had to worry about food again? Free yourself from the time and money you spend on food today, get healthy, and reduce your environmental impac

View analogueinteractive.com Pagerank   analogueinteractive.com alexa rank 29,348   analogueinteractive.com website value $ 282,960.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 05 Nov 2014 08:39:56 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
X-XSS-Protection: 1; mode=block; report=/xss-report/57cfc6af-1e43-4433-8647-777a45d3eb20?source[action]=index&source[controller]=shop&source[section]=storefront
X-Content-Type-Options: nosniff
X-UA-Compatible: chrome=1
X-ShopId: 1427122
X-ShardId: 3
Content-Encoding: gzip
ETag: cacheable:89959e57dac664bb9df58c0dc4d340f5
X-Alternate-Cache-Key: cacheable:1f08291b04cad858b7a85cfdc096bb4a
X-Cache: hit, server
X-Request-Id: 57cfc6af-1e43-4433-8647-777a45d3eb20
P3P: CP="NOI DSP COR NID ADMa OPTa OUR NOR"

Domain Information for analogueinteractive.com

Domain Registrar: FASTDOMAIN, INC. analogueinteractive.com registrar info
Registration Date: 2011-02-07 1 decade 3 years 2 months ago
Last Modified: 2014-01-23 1 decade 2 months 4 weeks ago
Expiration Date: 2015-02-07 9 years 2 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns1.fatcow.com analogueinteractive.com name server information 65.254.254.100 analogueinteractive.com server is located in United States United States
ns2.fatcow.com analogueinteractive.com name server information 65.254.254.101 analogueinteractive.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
analogueinteractive.com A 3595 IP:204.93.213.45
analogueinteractive.com NS 3599 Target:ns1.fatcow.com
analogueinteractive.com NS 3599 Target:ns2.fatcow.com
analogueinteractive.com SOA 3599 MNAME:ns1.fatcow.com
RNAME:dnsadmin.fatcow.com
Serial:2011111965
Refresh:10800
Retry:3600
Expire:604800
analogueinteractive.com MX 3599 Priority:5
Target:ALT2.ASPMX.L.GOOGLE.com
analogueinteractive.com MX 3599 Priority:10
Target:ALT3.ASPMX.L.GOOGLE.com
analogueinteractive.com MX 3599 Priority:5
Target:ALT1.ASPMX.L.GOOGLE.com
analogueinteractive.com MX 3599 Priority:1
Target:ASPMX.L.GOOGLE.com
analogueinteractive.com MX 3599 Priority:10
Target:ALT4.ASPMX.L.GOOGLE.com
analogueinteractive.com TXT 3599 TXT:v=spf1 ip4:38.113.1.0/24
ip4:38.113.20.0/24 ip4:65.254.224.0/19
?all
analogueinteractive.com TXT 3599 TXT:google-site-verification=kjUw4fWP6jRGQEw
5T1fBMO3zamApUa1qB3fpvtSpVck
analogueinteractive.com TXT 3599 TXT:google-site-verification=xxpQ906vGtpqibw
GrPn1PJlPFI9_l1rRzgK8SVtU9Go

Similarly Ranked Websites to Analogueinteractive

בשמים KOKO Perfume בושם לגבר בושם לאישה UA-53425768-1

analogueinteractive.com favicon - koko.co.il

בשמים KOKO Perfume בושם לאשה לגבר בושם לאישה במבצע מגוון קלווין קליין chanel בולגארי אליאן alien coco קוקו

View analogueinteractive.com Pagerank   Alexa rank for analogueinteractive.com 1,476,710   website value of analogueinteractive.com $ 480.00

Testberichte Erfahrungsberichte Blog

analogueinteractive.com favicon - allucansurf.de

Erfahrungsberichte Testberichte Fotos Bilder

View analogueinteractive.com Pagerank   Alexa rank for analogueinteractive.com 1,476,710   website value of analogueinteractive.com $ 480.00

شركة كشف تسربات المياه بالرياض (الموقع للايجار

analogueinteractive.com favicon - companydetectleakswaterinriyadh.com

شركات كشف تسربات بالرياض بأحدث وسائل مع الإصلاح بالضمان,وإصلاح تسربات المياه كشف تسربات المياه فى الرياض بدون تكسير باحدث اجهزة في كشف تسرب الماء في الجدار من

View analogueinteractive.com Pagerank   Alexa rank for analogueinteractive.com 1,476,711   website value of analogueinteractive.com $ 480.00

NBC Gas Mask Home - nbcgasmask.com

analogueinteractive.com favicon - nbcgasmask.com

View analogueinteractive.com Pagerank   Alexa rank for analogueinteractive.com 1,476,712   website value of analogueinteractive.com $ 480.00

IES JORGE JUAN / San Fernando | (Cádiz)

analogueinteractive.com favicon - iesjorgejuan.es

View analogueinteractive.com Pagerank   Alexa rank for analogueinteractive.com 1,476,712   website value of analogueinteractive.com $ 480.00