Web stats for Analogueinteractive - analogueinteractive.com
exceptional video game hardware
2.33 Rating by ClearWebStats
analogueinteractive.com is 1 decade 3 years 2 months old. This website has a #1,476,708 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 4 out of 10. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, analogueinteractive.com is SAFE to browse.
Traffic Report of Analogueinteractive
Daily Unique Visitors: | 326 |
Daily Pageviews: | 652 |
Estimated Valuation
Income Per Day: | $ 2.00 |
Estimated Worth: | $ 480.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | 289 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Excellent |
WOT Privacy: | Excellent |
WOT Child Safety: | Excellent |
Website Ranks & Scores
Google Pagerank
PR 4 out of 10
PageSpeed Score
84
Siteadvisor Rating
Not Applicable
Where is analogueinteractive.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | 150 |
Linkedin Shares: | 6 |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 5 |
Google Adsense: | Not Applicable | Google Analytics: | UA-22738499-3 |
Websites Hosted on Same IP (i.e. 204.93.213.45)
Corridor Digital | The Official Site. Find news and latest videos.
- corridor-digital.com
GOOD AS GOLD | Online Clothing Store | Mens & Womens Fashion | Streetwear | NZ
- goodasgold.co.nz
Good As Gold stocks the best fashion and streetwear brands from around the globe...
Soylent - Free Your Body
- soylent.me
What if you never had to worry about food again? Free yourself from the time and money you spend on food today, get healthy, and reduce your environmental impac
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 05 Nov 2014 08:39:56 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
X-XSS-Protection: 1; mode=block; report=/xss-report/57cfc6af-1e43-4433-8647-777a45d3eb20?source[action]=index&source[controller]=shop&source[section]=storefront
X-Content-Type-Options: nosniff
X-UA-Compatible: chrome=1
X-ShopId: 1427122
X-ShardId: 3
Content-Encoding: gzip
ETag: cacheable:89959e57dac664bb9df58c0dc4d340f5
X-Alternate-Cache-Key: cacheable:1f08291b04cad858b7a85cfdc096bb4a
X-Cache: hit, server
X-Request-Id: 57cfc6af-1e43-4433-8647-777a45d3eb20
P3P: CP="NOI DSP COR NID ADMa OPTa OUR NOR"
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 05 Nov 2014 08:39:56 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
X-XSS-Protection: 1; mode=block; report=/xss-report/57cfc6af-1e43-4433-8647-777a45d3eb20?source[action]=index&source[controller]=shop&source[section]=storefront
X-Content-Type-Options: nosniff
X-UA-Compatible: chrome=1
X-ShopId: 1427122
X-ShardId: 3
Content-Encoding: gzip
ETag: cacheable:89959e57dac664bb9df58c0dc4d340f5
X-Alternate-Cache-Key: cacheable:1f08291b04cad858b7a85cfdc096bb4a
X-Cache: hit, server
X-Request-Id: 57cfc6af-1e43-4433-8647-777a45d3eb20
P3P: CP="NOI DSP COR NID ADMa OPTa OUR NOR"
Domain Information for analogueinteractive.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
analogueinteractive.com | A | 3595 |
IP:204.93.213.45 |
analogueinteractive.com | NS | 3599 |
Target:ns1.fatcow.com |
analogueinteractive.com | NS | 3599 |
Target:ns2.fatcow.com |
analogueinteractive.com | SOA | 3599 |
MNAME:ns1.fatcow.com RNAME:dnsadmin.fatcow.com Serial:2011111965 Refresh:10800 Retry:3600 Expire:604800 |
analogueinteractive.com | MX | 3599 |
Priority:5 Target:ALT2.ASPMX.L.GOOGLE.com |
analogueinteractive.com | MX | 3599 |
Priority:10 Target:ALT3.ASPMX.L.GOOGLE.com |
analogueinteractive.com | MX | 3599 |
Priority:5 Target:ALT1.ASPMX.L.GOOGLE.com |
analogueinteractive.com | MX | 3599 |
Priority:1 Target:ASPMX.L.GOOGLE.com |
analogueinteractive.com | MX | 3599 |
Priority:10 Target:ALT4.ASPMX.L.GOOGLE.com |
analogueinteractive.com | TXT | 3599 |
TXT:v=spf1 ip4:38.113.1.0/24 ip4:38.113.20.0/24 ip4:65.254.224.0/19 ?all |
analogueinteractive.com | TXT | 3599 |
TXT:google-site-verification=kjUw4fWP6jRGQEw 5T1fBMO3zamApUa1qB3fpvtSpVck |
analogueinteractive.com | TXT | 3599 |
TXT:google-site-verification=xxpQ906vGtpqibw GrPn1PJlPFI9_l1rRzgK8SVtU9Go |
Similarly Ranked Websites to Analogueinteractive
בשמים KOKO Perfume בושם לגבר בושם לאישה UA-53425768-1
- koko.co.il
בשמים KOKO Perfume בושם לאשה לגבר בושם לאישה במבצע מגוון קלווין קליין chanel בולגארי אליאן alien coco קוקו
شركة كشف تسربات المياه بالرياض (الموقع للايجار
- companydetectleakswaterinriyadh.com
شركات كشف تسربات بالرياض بأحدث وسائل مع الإصلاح بالضمان,وإصلاح تسربات المياه كشف تسربات المياه فى الرياض بدون تكسير باحدث اجهزة في كشف تسرب الماء في الجدار من